Protein Info for Atu3996 in Agrobacterium fabrum C58
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to YJAB_SALTY: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu3996)MetaCyc: 50% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-
Predicted SEED Role
"GCN5-related N-acetyltransferase"
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CFX4 at UniProt or InterPro
Protein Sequence (148 amino acids)
>Atu3996 hypothetical protein (Agrobacterium fabrum C58) MITFRASNSRDTARILDIWSRAVDATHGFLLPADRAAIGEEVRAFLPQVPLMLAVDAADH ALGFMFLHEGHMEALFIDPDHHGKGIGKALVESALALHPALTTDVNEQNGEARGFYRRLG FEPTGRSDLDGQGRPYPLVHLRFRATQK