Protein Info for Atu3996 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13673: Acetyltransf_10
  • amino acids 52 to 127 (76 residues), 48.8 bits, E=1.4e-16
• PF13508: Acetyltransf_7
  • amino acids 62 to 123 (62 residues), 45.9 bits, E=1.2e-15
• PF00583: Acetyltransf_1
  • amino acids 67 to 121 (55 residues), 40.7 bits, E=5.4e-14
• PF08445: FR47
  • amino acids 68 to 122 (55 residues), 22.8 bits, E=1.5e-08

Best Hits

Swiss-Prot: 55% identical to YJAB_SALTY: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu3996)

MetaCyc: 50% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A9CFX4 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Atu3996 hypothetical protein (Agrobacterium fabrum C58)
MITFRASNSRDTARILDIWSRAVDATHGFLLPADRAAIGEEVRAFLPQVPLMLAVDAADH
ALGFMFLHEGHMEALFIDPDHHGKGIGKALVESALALHPALTTDVNEQNGEARGFYRRLG
FEPTGRSDLDGQGRPYPLVHLRFRATQK