Protein Info for Atu3988 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 413 (394 residues), 166.2 bits, see alignment E=5e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3988)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFX0 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Atu3988 MFS permease (Agrobacterium fabrum C58)
MTLAVTEQAGSRSAMALAAVCLSALMFGLEISSVPAILPTLEEVLQADFRQLQWIMNAYT
IGVTMVLMATGALADRFGRKRVFIASIVAFALSSLACGMTQSVSVLIGARFLQGLSGGAM
LVCQIAILSHQFRTARERGMAFGWWGIVSGVGLGFGPIIGGAIVALWSWEWVFLVHVVLG
IVTWLLAAGGVGESRDPEAARLDLAGMATLSVAVFCLAFFITQGPELGFANPMALLILGI
SVASFIAFVIAEKRTQRPMFDFSVFRIRPFSGAIIGSAAMNISFWPFMIYLPIWFQAGLG
YDSVTAGLGLLAYTLPALVMPPLAERLSLRYQPHLVIPAGLFTIGLGFMLMKFGSGIENA
SWLTMLPGCILAGIGLGLTNTPVTNTTTGAVSPARSGMASGIDMSARMISLAINIPIMGF
ILVEGVRASLRANLPVGTEMKALQSLAEKIAAGTVSTLPQEVSERLVHRALADGFGLVMV
YAGIGVWLLAALSYLVFGRQRWEGNE