Protein Info for Atu3972 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01073: 3Beta_HSD
  • amino acids 6 to 123 (118 residues), 29.8 bits, E=4.8e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 161 (156 residues), 48.6 bits, E=1.2e-16
• PF01370: Epimerase
  • amino acids 6 to 163 (158 residues), 67.8 bits, E=1.5e-22

Best Hits

Swiss-Prot: 61% identical to URODH_AGRFC: Uronate dehydrogenase (udh) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3972)

MetaCyc: 61% identical to D-uronate dehydrogenase moomer (Agrobacterium fabrum C58)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• D-galacturonate degradation II (5/5 steps found)
• D-glucuronate degradation II (5/5 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• D-glucuronate degradation III (2/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (22/31 steps found)
• D-galacturonate degradation III (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See A9CFW1 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Atu3972 hypothetical protein (Agrobacterium fabrum C58)
MLKRLLITGAGGKLGSMLRGRLGHVAQTIRLSDVVDLGSASPHEELVSCALEDEQAVHDL
VKGCDGIVHLGGVSVERAFDPIEAANLRGVYNLYEAARLNGMPRILFASSNHTIGYYPQG
QQLAPDTPFLPDGLYGVSKIFGEAMASLYHSKFGQETAIVRIGSCEEKPSNWRMLSTWLS
HGDFVSLIEATFRAPKLGCPVIWGVSANDDSWWDNSHVDFLGWQRRDNAADYRAEIERDV
SRPDPEAAIAKYQGGIFIDEPIHRT