Protein Info for Atu3970 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 116.5 bits, see alignment E=2.1e-37 PF17912: OB_MalK" amino acids 235 to 286 (52 residues), 40.4 bits, see alignment 6.8e-14 PF08402: TOBE_2" amino acids 279 to 348 (70 residues), 30.9 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 56% identical to MALK_YERPA: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu3970)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTR4 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Atu3970 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MASIQLRQVKKTYGALDVIKGVDLDIKHGEFCVFVGPSGCGKSTLLRMISGLEELSGGDI
VIGGDVVNTVPAADRGLAMVFQSYALYPHMTVRENLSFGLENIGTPKKDIAEKVTQVAKM
LQIDQLLERRPKDLSGGQRQRVAIGRAVVREPRVFLFDEPLSNLDAELRVDMRGEISNLH
RRLGNTMIYVTHDQVEAMTMADKIAVLRAGKLEQFGVPLDLYNRPANIFVAGFIGSPKMN
FFAGEVTSDATPSLKIATGELIPLPQTGFAYKSGQKVTLGIRPNHVQAGGEGALTMSVRT
AEQLGGESYLYGTLGDGTRVTLHLSGQTSTSADEVIRLSAPLEHIHLFDTTSGLTLRQD