Protein Info for Atu3964 in Agrobacterium fabrum C58

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF01408: GFO_IDH_MocA" amino acids 3 to 115 (113 residues), 66.1 bits, see alignment E=7.3e-22 PF22725: GFO_IDH_MocA_C3" amino acids 126 to 248 (123 residues), 86.8 bits, see alignment E=1.8e-28 PF02894: GFO_IDH_MocA_C" amino acids 129 to 334 (206 residues), 64.3 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3964)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12) / oxidoreductase domain" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.12

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFV5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Atu3964 dehydrogenase (Agrobacterium fabrum C58)
MVAKTHVLACAASSEKIRLKGIVDGGSGRAKALAAEASKHAGYEVAVYSSIEDAARDADV
DFAIIATPPNARIDIVGQLAKAGKHILMEKPVARNTEEADGIVALCRDAGVTLGIIFQHR
MRAASQKARELVDGGTLGALGLCEISVPWWRAQSYYDEPGRGTLARDGGGVLISQAIHTI
DLALSLTGPVARVQAMAATTRFHRMETEDYVSAGLRFKNGAVGSLVASTASFPGAAESIL
LHFDNASLRLASGLLHLDWRDGRQETFGGAAAGTGGGADPMAFTHEWHKGVFDDFADAIS
SGRPPVVTGEAALLSHRLIDAIINSADTGKEVELQDD