Protein Info for Atu3953 in Agrobacterium fabrum C58
Annotation: hydroxyproline-2-epimerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to 4HPE2_AGRRK: 4-hydroxyproline 2-epimerase 2 (Arad_8151) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
KEGG orthology group: None (inferred from 100% identity to atu:Atu3953)Predicted SEED Role
"Not a Proline racemase, nor 4-hydroxyproline epimerase [missing catalytic residues]" in subsystem Proline, 4-hydroxyproline uptake and utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CFV0 at UniProt or InterPro
Protein Sequence (332 amino acids)
>Atu3953 hydroxyproline-2-epimerase (Agrobacterium fabrum C58) MRHSFFCIDSHTCGNPVRLVAGGGPLLPHLPISERRDLFVRNHDWVRQALMFEPRGHDIM SGAVIYPAYRDDCDFAVIFIEVSGCLPMCGAGTIGLVTAAIEEGLVTPRIPGRLSIETPA GKVDIQYDKPGEFVESVRIFNVASYLHAADVEVNVPGLGKLVVDIAYGGNYYAVIEPQVG WPGLDGMTAGDVVDLSQKLRDALGTICDPVHPDDERIRGVHHAIWCDRPVSAEADGRGAV FYGDKAIDRSPGGTGTSARMAQLHGKGRLKAGETFRQESLIGTIFEGKVEEETTVGSFSG IRPSIGGWARIIGHNTIFVDDRDPLAHGFQVR