Protein Info for Atu3924 in Agrobacterium fabrum C58

Annotation: replication protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 261 to 279 (19 residues), see Phobius details TIGR03453: plasmid partitioning protein RepA" amino acids 18 to 402 (385 residues), 652 bits, see alignment E=1.4e-200 PF13614: AAA_31" amino acids 120 to 296 (177 residues), 124.3 bits, see alignment E=1.6e-39 PF06564: CBP_BcsQ" amino acids 120 to 283 (164 residues), 30.5 bits, see alignment E=8.3e-11 PF09140: MipZ" amino acids 121 to 160 (40 residues), 30.7 bits, see alignment 6.1e-11 PF01656: CbiA" amino acids 122 to 364 (243 residues), 91.4 bits, see alignment E=1.3e-29 PF02374: ArsA_ATPase" amino acids 125 to 266 (142 residues), 33 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 75% identical to REPA_AGRRH: Putative replication protein A (repA) from Agrobacterium rhizogenes

KEGG orthology group: None (inferred from 100% identity to atu:Atu3924)

Predicted SEED Role

"Plasmid replication protein RepA" in subsystem Plasmid replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTM7 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Atu3924 replication protein A (Agrobacterium fabrum C58)
MTQSADLRPAAGAPDLTSLIQQHSAALSAQLQAHNANTFSPHTEKSMRHFSPAETARLIG
IGEAYLRQIAAERPELDAAQASGRRSYSVEDMDEIRKFLDQGARGTRRYLPHRREGEELQ
VIAVMNFKGGSGKTTTSAHLAQYLALRGYRVLAIDLDPQASLSALFGHQPEIDVGPNETL
YGAIRYDDERRPIAEIVRGTYIPNLHIVPGNLELMEFEHDTPRALMRRAPGDTLFFARIG
QAIAQAQNFYDVVVIDCPPQLGYLTLSALTAATSVLVTVHPQMLDVMSMNQFLAMTGDLL
AEIGRAGARSDYNWMRYLITRFEPSDGPQNQMVAFLRSIFGENVLIHPMLKSTAVSDAGL
TNQTLFEVERTQFTRSTYDRALEAMNNVNAEIEGLIKKAWGRAA