Protein Info for Atu3918 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 352 to 389 (38 residues), see Phobius details PF06772: LtrA" amino acids 27 to 385 (359 residues), 332.9 bits, see alignment E=1.4e-103

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3918)

Predicted SEED Role

"Bll5714 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFU2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Atu3918 hypothetical protein (Agrobacterium fabrum C58)
MNTGNKTSRGKPEADSWIRREGEDAEKASFPELFFDLVFVFALIQLSHALAKDFGPTAAL
EAGILILSLWWLWIHTTWITNLLNTEKEPVRLLLFVLMFGGVLLAIALPKAFAELGLVFA
LIYSAMQVGRSLFALYAFKGEDRQSFLVLVRVTIWLTLSSLFWLAGGLVDLADRILLWGI
ALAIEYAGPACRYVVPGVPSSDEDRLHVSGEHLAERCALFVIICLGETILTTGRTATEYM
NSALTFLVFCSAFVSTVVMWWIYFHHGQEEASRKAENAEEKTKIAQNLFNYGHLPIVAGI
ILTAVGEDFSLSHAREGATMREAIAILGGPVLFLAGNIGVKIAAAYQRPVSHFAGVAALC
LLLPVPGIPLFVLQLASTGILLAVALWEYMALKRAVANA