Protein Info for Atu3895 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 25 to 168 (144 residues), 91.6 bits, see alignment E=1e-29 PF17912: OB_MalK" amino acids 242 to 287 (46 residues), 29.4 bits, see alignment 1.8e-10 PF08402: TOBE_2" amino acids 281 to 346 (66 residues), 21.2 bits, see alignment E=4e-08

Best Hits

Swiss-Prot: 40% identical to UGPC_SALTI: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Salmonella typhi

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu3895)

MetaCyc: 40% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFT5 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Atu3895 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MARITLDHIRHAYNAKAQAAGDYALKEVHHEWEDGGAYALLGPSGCGKTTLLNIISGLLR
PSEGRIAFDGTDVTDFATEDRNIAQVFQFPVVYDTMTVYDNLAFPLRNRQVPEAEVDRRV
REILEMTDLSGMAKRHARGLTADQKQKISLARGLVRSDVNAILFDEPLTVIDPHMKWVLR
SQLKRLHRQSGFTMVYVTHDQTEALTFADKVVVMYDGQIVQIGTPAELFERPGHTFVGYF
IGSPGMNVLPANIEGTTAVVGGLGVPLAGAPKVDGAQRIEIGIRPEFIRLERGGMPITID
KVEDIGRQKIVRARFAGQKLAIVVAEDEEIPAEAGVRFDPAAVGVFADSWRVKMGA