Protein Info for Atu3885 in Agrobacterium fabrum C58

Annotation: inositol monophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02067: histidinol-phosphatase
  • amino acids 6 to 255 (250 residues), 313.5 bits, E=5.4e-98
• PF00459: Inositol_P
  • amino acids 8 to 255 (248 residues), 172.8 bits, E=5.5e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3885)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

See Q7CTJ2 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Atu3885 inositol monophosphatase (Agrobacterium fabrum C58)
MLPDRDFFFKLADAASAETLPRFRTGIAVINKQDGGYDPVTEGDQAAETAIRALIEERFP
QHGILGEEHGNVGLDRDHIWVIDPIDGTRAFISGVPVWGTLIGFQSSGRATMGIMDQPFT
KERYFADGKAAWYFGPDGEKKIRTRDCASLSDAVLFTTTPHIFTAEEKPLYEKVQDQVRL
FRYGVDCYAYCLLAAGHVDLVIESGLKPYDVGALIPVIEQAGGTMTTWDGGRPENGGRIL
AAGSKAVHEEALAILSKL