Protein Info for Atu3870 in Agrobacterium fabrum C58

Annotation: D-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 3 to 327 (325 residues), 107.7 bits, E=3.7e-35
• PF02826: 2-Hacid_dh_C
  • amino acids 109 to 296 (188 residues), 167 bits, E=2.9e-53

Best Hits

Swiss-Prot: 54% identical to DDH_HAEIN: 2-hydroxyacid dehydrogenase homolog (ddh) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to atu:Atu3870)

MetaCyc: 53% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• L-alanine degradation II (to D-lactate) (3/3 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• heterolactic fermentation (12/18 steps found)
• vancomycin resistance I (1/3 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (2/6 steps found)
• mixed acid fermentation (9/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (2/8 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (2/9 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.28

Sequence Analysis Tools

See A9CFS1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Atu3870 D-lactate dehydrogenase (Agrobacterium fabrum C58)
MRIVVYSAKPYDRQFLDEAARPGTDLQYCEARLSPETVALADGAVAICAFVNDDLSRPVL
EKLAGMGVRLVALRCAGFNQVDLAAAEKLGLTIARVPAYSPYAVAEHTMALILSLNRKIH
RAYNRVREGNFALDGLLGFDLHGKTMGIVGTGKIGAIFARIAAGFGCRLIGHDLHPNPDC
EALGMTYGTREELFRTSDIVALMCPLTRETRHLIRRETLPLLKKGVMLINTSRGAIIDTP
AAITGLKDGTIGSLGIDVYEEEADLFFEDLSNDVLRDDVFARLLTFPNVLVTGHQGFFTQ
EALKNIADTTIGNIESFVDTGKALHAVSTEQLAGAVS