Protein Info for Atu3863 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 55 to 82 (28 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 3 to 201 (199 residues), 65.3 bits, see alignment E=6.1e-22 PF05992: SbmA_BacA" amino acids 38 to 250 (213 residues), 55.9 bits, see alignment E=4.9e-19

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to atu:Atu3863)

Predicted SEED Role

"FIG00984699: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTH2 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Atu3863 ABC transporter permease (Agrobacterium fabrum C58)
MTALNMREGLAKDMVDQWLKPGRAARLAGFGTISINPDQRLHDDVRNLAESSTALSIGLV
NATIILVSFIGVLWSLSAGFAITISGNTYAIPGYMVWAAIFYAGSASLLSNLVGYRLVGL
NAERYSKEAELRFSLMRASENLAAIALARGEKNERRRIGIDIDAVLGVIRGLAMALTHLT
WVSAGYGWLAVVAPILIAAPVYFSGNLTFGGLMMAVGAFNQVNTALRWYIDNFGPIASWK
ATLQRVSVFRNALIQMDSVEQHGLAIDLQRSVENEKIRLQSVIICRDAGGQDVERGFRLR
ENEVGIGPGERLMINGEQGVNRRLLFAAMAGLWPWGQGRIEMPEQSDTLFIAQHGYLPAG
SLREILAYPRAPQRFTDADYLAALIACGLGEMTSRLDENIRWDKKLDSDEQASIRIANAL
LLKPKFVVIDDLLEGLEKQTQDTLAQVLNGMEGAAIIYIGRSETFLSVLAPAVAHLDHAS
QKETSPKPDGTSQ