Protein Info for Atu3830 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 373 (339 residues), 164.1 bits, see alignment E=2.3e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3830)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFQ9 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Atu3830 MFS permease (Agrobacterium fabrum C58)
MSSQISSSSPGPAPAADPHIWAVLAVAVGTQTAGSFVSQGIYILVPFWREAFGVSLASAS
LAVTVMNGVQIATMFTLGRAIDIHGERRIVGIAMLGMAIAMACAATFANSLPALLVCIAF
LGGTYAAVQPGGTRAIMRWFPPAKRGIATGFRQAAVPFGTMIAAALLPFMAVRYGWHAAA
WLCAGVSIVGAALFWGLYREAGDVAAKTERPLPLAKLARIVGQDRSFWPVLRLGIAMSAF
QFTLTAHVIGFMADGLGLGLFVASSMFAAAQLAGIPGRILLPWLSDRFRPGLRGQSFGQV
SIIAASAAALLALLPIGTPSPVILLVLIILGIFGIGWFPLYLLQIAESAPKGSIASTIAF
ASTICLAVMAIGPYLFGLLVDSFGYGAAWSALIVPVVATAIPLAISSPRLPKAQTGSP