Protein Info for Atu3820 in Agrobacterium fabrum C58

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 47 to 79 (33 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 287 to 303 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 42 to 300 (259 residues), 131.6 bits, see alignment E=1.6e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu3820)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFQ3 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Atu3820 ribose ABC transporter permease (Agrobacterium fabrum C58)
MNELLSALSRYRVTIILGATLVIAALTVPGFVSLTTASLGLDRGASIGIVAIGLTVLLIA
GQIDLSVGAVFALSGIVAISLQAELGIWPAAALGVLTGIAAGVFNGILTVVFKINALVAT
LASMLIFRSLAHWITGSQPVSGTDITFAVTLSQVYAEIFTTRSALFMAGIVMLDFWLRRT
VSGRNLFAVGSNPVAAEASGISSGRTLFLGFIFAGALAGLAGVFESLTTNTGSPVFGAEI
TVVIIAAVVVGGTRLEGGRGSALGTLGGVLTIAALTTAMEFQSVPAYVQQIVNGLILILL
VVLDRTVRARPRPAMPILKSL