Protein Info for Atu3817 in Agrobacterium fabrum C58

Annotation: dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF08666: SAF" amino acids 11 to 77 (67 residues), 36.5 bits, see alignment E=8.8e-13 PF04295: GD_AH_second" amino acids 108 to 250 (143 residues), 146.8 bits, see alignment E=6.6e-47 PF20629: GD_AH_C" amino acids 260 to 501 (242 residues), 340.1 bits, see alignment E=9.5e-106

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3817)

MetaCyc: 62% identical to D-arabinonate dehydratase (Herbaspirillum huttiense)
Arabinonate dehydratase. [EC: 4.2.1.5]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFQ1 at UniProt or InterPro

Protein Sequence (503 amino acids)

>Atu3817 dehydratase (Agrobacterium fabrum C58)
MARYIKLTETDNIIVAVEPITLGESVAEVTARERIPRGHKMALQAIANGTPIVKYGQIIG
FSTRDIEPGQWVHEHNVTMQSFERGYASGEEARPTRYVEPEKRHSFNGFRRPSGRFGTRN
YIAVLTSVNCSATASRFIADEINRSGILDQFPNVDGVISLVHGTGCGLDIHGEAYELLKR
TQWGVAKNPNVGGVLMVGLGCEAFQIPRWMDAYGLRESETFRTLTIQELGGTRKTVEAGV
VAIREMLPVVNKAIRVPAPASELMLALQCGGSDGYSGITANPALGIAADILIAEGGTAIL
SETPEIYGAEHLLIRRAERPEVGEKLAERIRWWENYTRRHDMEMNNNPSPGNKAGGLTTI
LEKSLGAAMKGGSTNLTAVFNYAEPVDARGLVFMDTPGYDPVSATGQVAGGANILCFTTG
RGSAFGCKPTPSIKLASNSYIFEKMGEDMDINCGDVLDGKTLQQKGEEIFTRILAVASGE
RTKSELLGYGDNEFVPWSIGATM