Protein Info for Atu3802 in Agrobacterium fabrum C58

Annotation: proline/glycine betaine ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 36 to 266 (231 residues), 348.2 bits, see alignment E=2.7e-108 PF00005: ABC_tran" amino acids 43 to 191 (149 residues), 114.3 bits, see alignment E=7.2e-37

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 100% identity to atu:Atu3802)

MetaCyc: 38% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32 or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFP0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Atu3802 proline/glycine betaine ABC transporter ATPase (Agrobacterium fabrum C58)
MTDIHIRNVSKIFGGNWKAALSMAQQGAEKSAILAKTGCSVGLDNVSLDIEAGRIFVIMG
LSGSGKSTLVRHINRLIEPTSGEILVGGDNVLALKAKELRDFRNRRVSMVFQNFGLMPHR
TVLQNVVYGQRVRGLTKADARPIGMKWIETVGLSGYEDKFPHQLSGGMKQRVGLARALAA
DTDVILMDEAFSALDPLIRADMQDQLLQLEKNLHKTIVFITHDLDEALRIGAQIAILKDG
KLVQVGTPDQILNSPANDYVARFVERRAGAAGESRHG