Protein Info for Atu3801 in Agrobacterium fabrum C58

Annotation: proline/glycine betaine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 254 to 270 (17 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 272 (163 residues), 103.6 bits, see alignment E=5.4e-34

Best Hits

Swiss-Prot: 46% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to atu:Atu3801)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTC3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Atu3801 proline/glycine betaine ABC transporter permease (Agrobacterium fabrum C58)
MFPEVFHISIRGPINEIVRSLVVNYGYVFKAISQTILQAILFVEWALRGLPWWAIFLVFL
VLAWFAAKKISLVIMVAVMLFIVGALGLWDLTMQTLALMLIASLISIVIGVPIGILLAKS
EWARRITLPILDVMQTMPSFVYLIPAIMLFGLGKVPAVLATIVYAAPPLIRLTDLGIRQV
DREVVEAATAFGGSPRQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQ
VLNGIQTLDVGKGLEAGLGIVILAIVLDRITQGFGQSSRKEMGND