Protein Info for Atu3774 in Agrobacterium fabrum C58

Annotation: capsule expression protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF01380: SIS" amino acids 55 to 182 (128 residues), 99.7 bits, see alignment E=1.2e-32 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 55 to 321 (267 residues), 304 bits, see alignment E=5.5e-95 PF00571: CBS" amino acids 210 to 267 (58 residues), 30.6 bits, see alignment E=3.5e-11 amino acids 275 to 328 (54 residues), 38.7 bits, see alignment 1.1e-13

Best Hits

Swiss-Prot: 50% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3774)

MetaCyc: 48% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Polysialic acid capsule sugar isomerase, KpsF/GutQ family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT99 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Atu3774 capsule expression protein (Agrobacterium fabrum C58)
MITRAVKLVEDNAIESAVRTISMERAGLAALEDALRNGLSEPFCKAIETIGQSNGRLIIT
GVGKSGHIGAKLAATFASTGTPAFFVHAAEANHGDLGMIGGDDVVLAISKGGESAELRSI
INYSRRFSIPLIALTCSENSSLARASDIVLLVPNEQEACPLGLAPTTSTLMQLALGDALA
VALLEARNFTAGDFKVFHPGGKLGASLTLVSDIMHTGDRVPLVNKGTAMPEAVGVLSRKH
FGCVGILDEDGRLCGIVTEGDMARNLSRNLAELVVDDIMTRSPKTVKKSVLATSALATLE
KFHIGALIVVDDDNRPIGLVHFHDLLRIGVA