Protein Info for Atu3749 in Agrobacterium fabrum C58

Annotation: enhanced entry protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF08238: Sel1" amino acids 124 to 159 (36 residues), 29.3 bits, see alignment 4.9e-11 amino acids 160 to 195 (36 residues), 15.8 bits, see alignment 8.5e-07 amino acids 271 to 304 (34 residues), 18.7 bits, see alignment 1e-07 amino acids 306 to 337 (32 residues), 14.9 bits, see alignment (E = 1.7e-06)

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to atu:Atu3749)

Predicted SEED Role

"FOG: TPR repeat, SEL1 subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT78 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Atu3749 enhanced entry protein (Agrobacterium fabrum C58)
MIQAMFMRSVPLCLSVSLLALAFGAPAGVAFAQSGPQSESNAMSRQLENEAQPTRQGRVQ
SEEQKDLEPSSGVNVYQRMGADLPALPPEKEFKGRVDEAYGHFQRGEYVQALDKALTRAQ
NGDASAQTLVAEMMSRGLGIARDEKTAAFWYQQAAEGGDPVAMFKFALILMEGKFVTRDK
AKADDFMRRAAEAGNASAQFNWGQILVSENPGAKGLLMALPFYEKSAEQGIADAQYAVSQ
IYWSVKDVPTEKKAKARDWLMRAAKAGYDTAQVDLGVWLVNGFGGERNLDEGFRWLYGAA
QRGNVVAQNKVAHLYVQALGTRPDPVEAAKWYVLSRRAGLKDPRLEDFYLGITDEQQKKA
IEAANRFRPT