Protein Info for Atu3741 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 230 (219 residues), 42.6 bits, see alignment E=3.8e-15 amino acids 204 to 387 (184 residues), 73.6 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3741)

Predicted SEED Role

"TRANSPORTER, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFL2 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Atu3741 MFS permease (Agrobacterium fabrum C58)
MSRNLLPVFALLSSTLFLFLGNGLQGLILPMRGSAEGYSNEILGFLGTSWAAGFVIGCFV
APAIVRRAGHVRAFGSFVALVCLTVLMTGLVVDDVWWITLRALTGFCTAGTSMIIESWLN
ERATNESRGMIFSLYIAITLLGVVAGQMIVPMGDVSNTSLFMICGIIYCIAILPATLSKA
ASPQPLQKVKLDLPALYRNSPVSFVGILMIGIANGAYGTLGAVFGARAGLDPTMIAIMVS
VTIFVGALAQFPAGRLSDRIDRRYVLAGLAGLGAVAGLAVAAVQPHEVYVLIPMIAIYGA
AANALYPIAVAHANDFAASEDFVKVSGGLLLLYGIGTIIGPTLGGAVMTYSGPYALFFVT
AVAHVLITAYAIIRSRQRAALSTAEKDNFSTMMPTTPSPLVTPESIALDPRAPQYPGDDG
DYVEKGAGI