Protein Info for Atu3738 in Agrobacterium fabrum C58

Annotation: potassium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 188 to 214 (27 residues), see Phobius details amino acids 225 to 254 (30 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 387 (372 residues), 168.6 bits, see alignment E=1e-53

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to atu:Atu3738)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT69 at UniProt or InterPro

Protein Sequence (621 amino acids)

>Atu3738 potassium/proton antiporter (Agrobacterium fabrum C58)
MESFYLLLLVATVLVLVAAFSSLIAFRFGAPLLLLFLVIGLAAGVDGLGIEFTNNPLAYM
LGSLILAVILFDSGFGTSLQSFRLSAAPAVALATVGVILTSVFFAGAAALLLGLSWLEGL
LLGAIVASTDAAAVFFLLRIGGIHIRDQVRSTLEVESGTNDPMAIFLTVALVEIVAKGQG
LAGIDSGFLLLFIEEMGLGVIFGLLGGLMIATVVNRFAADRGLAPIFVLALALLVFSFTG
AIGGSGFLAVYVAGIVAGNRRIFAKETIRRFHEGLTWLAQIIMFLMLGLLATPSQFPAIA
IPAVLLALFLIFVARPLAVWLSLMPFNYTQQETSFVAWVGLRGAVSILLAIMPILGGLDD
AQIYFNAAFIIVLVSLLVQGWTIKPVATRLGLIVPPRMGEVDKLEVDLPGTANHELISYR
VAKGSAIMQGERIPRWAMPSLVVRDGKSIRYQYAGRLRENDLVYLFIAPNYTRLIDRLFA
SALPVADDDADFFGIFTISPSRPAKEMEAAYGPGLISPAEHAMTIAELIETRLAGKAGYA
DRVRLGPLVLIVRALDEQEAITGVGISLEPVEPAIGLPIFISFSDILRRARTHLAQRRQL
RSADAGEGVSAPAKTVTENEA