Protein Info for Atu3737 in Agrobacterium fabrum C58

Annotation: glyceraldehyde 3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 3 to 105 (103 residues), 125.1 bits, E=1.2e-40
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 4 to 326 (323 residues), 430.2 bits, E=2.7e-133
• PF02800: Gp_dh_C
  • amino acids 159 to 315 (157 residues), 225.3 bits, E=3e-71

Best Hits

Swiss-Prot: 81% identical to G3P_XANFL: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Xanthobacter flavus

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to atu:Atu3737)

MetaCyc: 58% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13) / NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12, EC 1.2.1.13)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• gluconeogenesis I (11/13 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• glycolysis I (from glucose 6-phosphate) (9/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• heterolactic fermentation (12/18 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Sequence Analysis Tools

See A9CFL0 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu3737 glyceraldehyde 3-phosphate dehydrogenase (Agrobacterium fabrum C58)
MTVKVAINGFGRIGRNVLRAIVESGRTDIEVVAINDLGPVETNAHLLRYDSIHGKFPADV
KVEGDTIIVGGGKPIKVTAVRDPATLPHKELGVDIALECTGIFTARDKAAAHLTAGAKRV
IVSAPADGADLTVVFGVNDDQLTKDHLVISNASCTTNCLVPVVKVLDDVIGIDHGFMTTI
HSYTGDQPTLDTMHKDLYRARAAALSMIPTSTGAAKAVGLVLPHLKGKLDGTSIRVPTPN
VSVVDFKFIAKRDTTVEEVNEAIKSASNGKLKGILGYTEEPLVSRDFNHDSHSSIFAIDQ
TKVMEGNFVRVLSWYDNEWGFSNRMSDTAVAFAKTI