Protein Info for Atu3736 in Agrobacterium fabrum C58

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 3 to 195 (193 residues), 29.2 bits, E=1.8e-10
• PF00456: Transketolase_N
  • amino acids 7 to 331 (325 residues), 463.9 bits, E=8.4e-143
• TIGR00232: transketolase
  • amino acids 9 to 657 (649 residues), 842.6 bits, E=1e-257
• PF00676: E1_dh
  • amino acids 109 to 233 (125 residues), 34.1 bits, E=4.6e-12
• PF02779: Transket_pyr
  • amino acids 352 to 522 (171 residues), 183.9 bits, E=6.4e-58
• PF22613: Transketolase_C_1
  • amino acids 537 to 647 (111 residues), 125.2 bits, E=4.5e-40
• PF02780: Transketolase_C
  • amino acids 545 to 651 (107 residues), 49.5 bits, E=1.2e-16

Best Hits

Swiss-Prot: 66% identical to TKT1_XANFL: Transketolase 1 (tkt) from Xanthobacter flavus

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to atu:Atu3736)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See A9CFK9 at UniProt or InterPro

Protein Sequence (660 amino acids)

>Atu3736 transketolase (Agrobacterium fabrum C58)
MISRDKHNRMANAIRFLAMDAVEKANSGHPGLPMGAADVATVLFTRYLKFDPKAPLWADR
DRFVLSAGHGSMLLYSLLYLTGYEDMTIDEIKRFRQFGSKTAGHPEYGHATGIETTTGPL
GQGIANAVGMAIAERKLEEEFGSDLQSHFTYVLCGDGCLMEGISHEAIALAGHLKLNKLV
LFWDDNNITIDGEVGLSDSTDQIARFQAVHWNTIRVDGHDPDAIAAAIEAAQKSDRPTFI
ACKTVIGFGAPNKQGTHKVHGNPLGAEEIAAARKSLNWEAEAFVIPEDVLDAWRLAGLRS
TKTRQDWEARLEATETAKKAEFKRRFAGDLPGNFDSSIDAFKKKIIENNPTVATRKASED
SLEVINGILPEMVGGSADLTPSNNTKTSQMKSITPTDFSGRYLHYGIREHGMAAAMNGIA
LHGGLIPYAGGFLIFSDYCRPSIRLAALMGIRVVHVLTHDSIGVGEDGPTHQPVEQIAAL
RAIPNLLVFRPADETETAECWQLALEQKHRPSALALTRQNLTPSRKEYEEKNLSAYGAYE
LVSASDAKVSIFASGSEVEVALKAAATLKDKGVSARVVSVPCFELFKEQPETYRNAIIGK
APVKIAVEAAIRQGWDYFIGNDGAFVGMHSFGASAPAKDLFKHFGITAEAVVAAVEAKLA