Protein Info for Atu3732 in Agrobacterium fabrum C58

Annotation: hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details PF01595: CNNM" amino acids 7 to 198 (192 residues), 162.6 bits, see alignment E=1.2e-51 PF00571: CBS" amino acids 219 to 271 (53 residues), 21.8 bits, see alignment 2.9e-08 amino acids 278 to 332 (55 residues), 29 bits, see alignment 1.7e-10 PF03471: CorC_HlyC" amino acids 347 to 423 (77 residues), 73.8 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: K03699, putative hemolysin (inferred from 100% identity to atu:Atu3732)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT66 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu3732 hemolysin (Agrobacterium fabrum C58)
MFTEIMIVVLLTVLNGVLAMSELAVVSSRPARLKVLAAQGSRGATMALGLSENPGRFLST
VQIGITLVGVLSGAFSGATLGARFTGWLLEQGVPDRAADAIGVGSVVVAITYLSLIVGEL
VPKQIALRDPEKIAARVAPTMVMLSRIGAPLVWLLDKSGKVVLAILGHSGESNASVTDDE
IRTVLAEAHSAGVIETEESAMITSVMRLADRNARGLMTPRRDVEVVDIEDSAEEIREQLR
QTQRSRLPVRNGASDEILGVLFAKDAFDALASGKELDVRELLREVPVVSDLTSAVDVIQS
LRRSTVHMVLVYDEYGHFEGIVSSGDVLEAITGAFQEDNDEEPAMVEREDGSFLVAGWMP
ADEFAYRMGFQIDEDAEFETVAGLVLDEFRRLPELGEHITRNGWRFEVIDLDGHRIDKVL
VSRAA