Protein Info for Atu3716 in Agrobacterium fabrum C58

Annotation: tolR protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 33 to 57 (25 residues), see Phobius details TIGR02801: protein TolR" amino acids 27 to 147 (121 residues), 133.3 bits, see alignment E=4e-43 PF02472: ExbD" amino acids 28 to 148 (121 residues), 101.5 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 36% identical to EXBD_NEIGO: Biopolymer transport protein ExbD (exbD) from Neisseria gonorrhoeae

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to atu:Atu3716)

MetaCyc: 37% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFK3 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Atu3716 tolR protein (Agrobacterium fabrum C58)
MGMSAGGSGGSGGRRGGRGGRRRGGAISEINVTPLVDVMLVLLIIFMVAAPMMTVGVPID
LPQTSANALNSDTQPITISVNANGQIHLQETEIQAAEVADKLQAIATTGYNERIFVRADS
VAAYGVVADVMARIQAAGFKNIGLVTQQKQDN