Protein Info for Atu3714 in Agrobacterium fabrum C58

Annotation: translocation protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 20 to 431 (412 residues), 517.4 bits, see alignment E=1.4e-159 PF04052: TolB_N" amino acids 29 to 131 (103 residues), 116.8 bits, see alignment E=7.1e-38 PF07676: PD40" amino acids 242 to 274 (33 residues), 31 bits, see alignment (E = 2.9e-11) amino acids 284 to 319 (36 residues), 46.1 bits, see alignment 5.2e-16 amino acids 371 to 407 (37 residues), 29.1 bits, see alignment 1.1e-10

Best Hits

Swiss-Prot: 100% identical to TOLB_AGRFC: Tol-Pal system protein TolB (tolB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to atu:Atu3714)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9L4 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Atu3714 translocation protein TolB (Agrobacterium fabrum C58)
MKIFSPIRLVLAIAALMSVFSAPAFARVEININKGNVEPLPIAITDFMSSDGIGAQVSAV
IAADLQRSGLFAPVNKNAFIEKISNPDQQPRFEDWKVINAQALVTGRVTRESDGRLRAEF
RLWDTFAGQQLSGQQFFTQPENWRRVAHIIADAIYERVTGEKGYFDTRVVFVSESGPKTA
RKRQLSIMDQDGFNVRNLTNSNDIVLTPRFSPNRQEVTYMSFEGQQPRVYLLQLETGQRE
VVGNFPGMTFSPRFSPDGQKVIMSLQQDGNANIYTMDLRSRTTTRLTNTAAIDTAPSYSP
DGQRVAFESDRGGRQQIYVMNADGSGQQRVSFGDGSYSTPVWSPRGDLIAFTKQSGGKFS
IGVMKTDGSGERILTSGFHNEGPTWAPNGRVLMFFRQNAGAGGPQLYSIDLTGYNEQLIK
TPTFASDPAWSPLLD