Protein Info for Atu3713 in Agrobacterium fabrum C58

Annotation: omp16 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 69 to 171 (103 residues), 144.3 bits, see alignment E=6e-47 PF00691: OmpA" amino acids 71 to 159 (89 residues), 76.1 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 100% identical to PAL_AGRFC: Peptidoglycan-associated lipoprotein (pal) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 100% identity to atu:Atu3713)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9L5 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Atu3713 omp16 protein (Agrobacterium fabrum C58)
MSRTNISALSPMQKLARNPAVIAMTLALALAGCANKKNMPNSAGELGLGGAGSATPGSQQ
DFTVNVGDRIFFDTDSTSIRADAQQTLQRQAQWLSRYPNYAITVEGHADERGTREYNLAL
GARRAAATRDFLASQGVPASRMKTISYGKEKPVAVCDDISCWSQNRRAVTVLGGAGM