Protein Info for Atu3709 in Agrobacterium fabrum C58

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 136 (134 residues), 154.4 bits, E=3.1e-49
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 444 (439 residues), 646.9 bits, E=7.1e-199
• PF02879: PGM_PMM_II
  • amino acids 159 to 256 (98 residues), 62.3 bits, E=1.1e-20
• PF02880: PGM_PMM_III
  • amino acids 260 to 368 (109 residues), 124 bits, E=6.6e-40
• PF00408: PGM_PMM_IV
  • amino acids 376 to 443 (68 residues), 64.6 bits, E=1.4e-21

Best Hits

Swiss-Prot: 100% identical to GLMM_AGRFC: Phosphoglucosamine mutase (glmM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to atu:Atu3709)

MetaCyc: 51% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• peptidoglycan recycling I (8/14 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Sequence Analysis Tools

See Q8U9L9 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Atu3709 phosphoglucosamine mutase (Agrobacterium fabrum C58)
MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN
ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK
LSDELELEIEDLLDKDIYAQLAKPAEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA
IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKLHEVRADIGI
ALDGDADRVIIVDERGEIVDGDQLMAVIADSWAADNTLRGGGIVATVMSNLGLERFLGDK
GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL
TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVLQAIADAESALANNGRLVIRPSGTEPLI
RVMAEGDDSAKVEKIVNDLVGVISSARSAA