Protein Info for Atu3703 in Agrobacterium fabrum C58

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF03054: tRNA_Me_trans" amino acids 1 to 198 (198 residues), 231.4 bits, see alignment E=1.7e-72 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 1 to 357 (357 residues), 299.4 bits, see alignment E=1.5e-93 PF00733: Asn_synthase" amino acids 2 to 88 (87 residues), 23.8 bits, see alignment E=6.7e-09 PF20259: tRNA_Me_trans_M" amino acids 216 to 267 (52 residues), 62.5 bits, see alignment 4.3e-21 PF20258: tRNA_Me_trans_C" amino acids 276 to 357 (82 residues), 42.9 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 100% identical to MNMA_AGRFC: tRNA-specific 2-thiouridylase MnmA (mnmA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to atu:Atu3703)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9M5 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Atu3703 tRNA-specific 2-thiouridylase MnmA (Agrobacterium fabrum C58)
MSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCCAGQDIDDARRVCETLGIP
HYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFADLLATAQELGADALATGHY
IRSRPNPVSGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYLRFPLGGLSKAETRALAEE
MGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHLDGRVLGRHDGIVHYTIGQ
RRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDMNWLGDGALAADAGQGFTC
FAKVRSTRPPTEAVLHADENGIYVDLMTGEAGVAPGQACVLYSAPGPDARVYGGGFIDRS
ERSVDAEASLKALLEKPVAA