Protein Info for Atu3691 in Agrobacterium fabrum C58

Annotation: iron (III) dicitrate ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00005: ABC_tran" amino acids 23 to 171 (149 residues), 110.8 bits, see alignment E=1.7e-35 PF13304: AAA_21" amino acids 34 to 81 (48 residues), 29.3 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 55% identical to YUSV_BACSU: Probable siderophore transport system ATP-binding protein YusV (yusV) from Bacillus subtilis (strain 168)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to atu:Atu3691)

MetaCyc: 50% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Iron(III) dicitrate transport ATP-binding protein FecE (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFJ6 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Atu3691 iron (III) dicitrate ABC transporter ATPase (Agrobacterium fabrum C58)
MHEAYRLATRNLSLGYNGAVIVEDLNLKIPSGHFTVLVGKNGCGKSTILRALAGLLSPMK
GEIFLDGASTRKIPSRERAKHIGVLTQGPQAPEGLSVTELVRQGRYPHRRLFERWSSRDE
DACTYALDLTDMTSLSDRPVEALSGGQRQRAWIAMTLAQETDILLLDEPTTFLDLAHQIE
ILDLIRQLVHDQGRTIVAVLHDLNQAARYADEIVLVRDGRIFDAGAPGAVITAKNVLDVF
GVNAVIMPDPISGTPMCVPIPSQTQGK