Protein Info for Atu3630 in Agrobacterium fabrum C58

Annotation: acetyl-CoA carboxylase carboxyltransferase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit" amino acids 2 to 315 (314 residues), 416.1 bits, see alignment E=5.5e-129 PF03255: ACCA" amino acids 4 to 314 (311 residues), 469.2 bits, see alignment E=6.1e-145 PF01039: Carboxyl_trans" amino acids 100 to 246 (147 residues), 75.9 bits, see alignment E=2.7e-25

Best Hits

Swiss-Prot: 100% identical to ACCA_AGRFC: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 100% identity to atu:Atu3630)

MetaCyc: 50% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9U5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu3630 acetyl-CoA carboxylase carboxyltransferase subunit alpha (Agrobacterium fabrum C58)
MHNYLDFEKPISDLEGKIIELKKLADEDESIDTSEEINRLESRVNDAMQDIYSKLNAWQK
TQVARHPQRPHFVDYAKSLFTDFTPLAGDRKFSEDAAIQAGLARFNGQPVAIIGQEKGND
TKSRLKHNFGSARPEGYRKAIRVLELADRFSLPVVTLIDTAGAYPGVGAEERGQAEAIAR
STEMCLNVKVPIVSVVIGEGGSGGAIAIATGNRVYMLEHSVYSVISPEGAASILWRDSTR
AKEAATNMKITSEDLKSLGVIDGIIPEPIGGAHRAPETVISATGDVIAKALADLSQRSGT
QLRAERRQKFLDIGRNL