Protein Info for Atu3610 in Agrobacterium fabrum C58

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF04752: ChaC" amino acids 4 to 171 (168 residues), 162.8 bits, see alignment E=9e-52 PF06094: GGACT" amino acids 6 to 114 (109 residues), 24.4 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: K07232, cation transport protein ChaC (inferred from 100% identity to atu:Atu3610)

Predicted SEED Role

"Cation transport protein chaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFG2 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Atu3610 transporter (Agrobacterium fabrum C58)
MDDFWVFGYGSLMWNPGFAFEERQQARLHGYRRSLCISSNFYRGTEEKPGLVLGLERGGS
CLGVAFRVRGKDHDPVMAYLRERELVTNVYKERVVSIALANGRRGSAVTYVADPAHEQYI
GGLGVAESAVIIAAATGRSGPNTDYLFNTVQHLQEMGIRDSLLESIAASVGTLSAQSAVV
SLP