Protein Info for Atu3596 in Agrobacterium fabrum C58

Annotation: electron transfer flavoprotein alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF01012: ETF" amino acids 4 to 169 (166 residues), 131.8 bits, see alignment E=2.5e-42 PF00766: ETF_alpha" amino acids 189 to 270 (82 residues), 114.4 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 76% identical to ETFA_BRADU: Electron transfer flavoprotein subunit alpha (etfA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 100% identity to atu:Atu3596)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSV6 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Atu3596 electron transfer flavoprotein alpha subunit (Agrobacterium fabrum C58)
MAILLLAEHDNATLSDLTAKTLTAATQIGGDVHVLVAGSGAKAAADAAAKLTGVSKVLLA
DDASYANALAEPLAALVVSLSPAYDVIIAPATASAKNVLPRVAALLDVAQVSEIIEVVSP
DTFKRPIYAGNAIQTVQASDAKKVITVRPTAFAAAAEGGSASVETIATAENPGVSSFVSD
ALASSDRPELTSAKIIISGGRALGSSEKFKEVILPVADKLGAAVGASRAAVDAGYAPNDW
QVGQTGKVVAPQLYIAAGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVADLFE
ALPELQKAL