Protein Info for Atu3590 in Agrobacterium fabrum C58

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 243 to 267 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 16 to 274 (259 residues), 88.1 bits, see alignment E=4.3e-29 PF03631: Virul_fac_BrkB" amino acids 21 to 273 (253 residues), 158.3 bits, see alignment E=1.5e-50

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to atu:Atu3590)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFF0 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Atu3590 transporter (Agrobacterium fabrum C58)
MVAAVRLAGKVAFDAYSHFAEDDGWAMASHMALSILLALFPFLIFGTALAGFLGADQFSE
TAVHLIFDTWPEAIAGPLAAQVQQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY
RVTETRWWYVTRLLSLLYVLIAVVVFTGISIVLVAVPVATSFAEARFPWLTDLLNTVSSL
GLYGTIVVLTAGLVAAHLWLPAGKRRIWDVWPGILLTMIFWVIGAAIFAYYLSTFANYAA
TYAGLASVMVVLVFLYMVGVIFMLGAEVNAALMKYKVRQIIRRNIGSNGPRRERALDETD
KPADI