Protein Info for Atu3586 in Agrobacterium fabrum C58

Annotation: propionyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 83% identical to PCCB_RHOS4: Propionyl-CoA carboxylase beta chain (pccB) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01966, propionyl-CoA carboxylase beta chain [EC: 6.4.1.3] (inferred from 100% identity to atu:Atu3586)

MetaCyc: 83% identical to propionyl-CoA carboxylase beta subunit (Cereibacter sphaeroides)
Propionyl-CoA carboxylase. [EC: 6.4.1.3]

Predicted SEED Role

"Propionyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.3)" in subsystem Propionyl-CoA to Succinyl-CoA Module or Serine-glyoxylate cycle (EC 6.4.1.3)

MetaCyc Pathways

propanoyl CoA degradation I (3/3 steps found)
anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
2-oxobutanoate degradation I (3/4 steps found)
3-hydroxypropanoate cycle (8/13 steps found)
methylaspartate cycle (12/19 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
superpathway of L-methionine salvage and degradation (8/16 steps found)
superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
mycolate biosynthesis (21/205 steps found)
superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.3

Use Curated BLAST to search for 6.4.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSU7 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Atu3586 propionyl-CoA carboxylase (Agrobacterium fabrum C58)
MPGILEQLETRRQEARLGGGVKRIEAQHAKGKLTARERIDVLLDEGSFEEYDMYVTHRAV
DFGMAEQKVAGDGVVTGWGTINGRQVYVFSQDFTVLGGSLSETHAQKICKIMDMAVRNGA
PVIGLNDSGGARIQEGVASLGGYADVFKRNVVASGVVPQISVIMGPCAGGAVYSPAMTDF
IFMVRDTSYMFVTGPDVVKTVTNEIVTAEELGGASTHTKKSSVADGAYENDIETLEHVRL
LFDFLPLNNREKPPVRPFHDDPARLEARLDTLIPDSSNKPYDMKELIHALADEGDFFELQ
EAFARNIITGFIRLEGQTVGVVANQPMVLAGCLDIDSSRKAARFVRFCDAFNIPLLTLVD
VPGFLPGTAQEYGGVIKHGAKLLFAYSEATVPMVTLITRKAYGGAYDVMASKHIGADVNY
AWPTAEIAVMGAKGAAEILYRSELADPEKIAARTKEYEERFANPFVAAERGFIDEVIMPH
SSRRRIARAFASLRNKSVETRWKKHDTIPL