Protein Info for Atu3579 in Agrobacterium fabrum C58
Annotation: lactoylglutathione lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 100% identity to atu:Atu3579)MetaCyc: 71% identical to ethylmalonyl-CoA/methylmalonyl-CoA epimerase (Cereibacter sphaeroides)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]; 5.1.99.1 [EC: 5.1.99.1]
Predicted SEED Role
"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)
MetaCyc Pathways
- propanoyl CoA degradation I (3/3 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
- 2-oxobutanoate degradation I (3/4 steps found)
- pyruvate fermentation to propanoate I (4/7 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- methylaspartate cycle (12/19 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- superpathway of L-methionine salvage and degradation (8/16 steps found)
- L-glutamate degradation VIII (to propanoate) (4/11 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
- ethylmalonyl-CoA pathway (3/11 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
- crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.1.99.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7CSU2 at UniProt or InterPro
Protein Sequence (138 amino acids)
>Atu3579 lactoylglutathione lyase (Agrobacterium fabrum C58) MFGRLNHVALAVPDLDAAVSRYRALGAQVSEPQALPEHGVTVVFIAADNTKIELLHPLGE NSPIAAFLERNPGGGTHHLCFEVPDILVARDDLLKKGVRILGDGEPKIGAHGNPVLFLHP KDMGGVLYELEQVSQTHG