Protein Info for Atu3575 in Agrobacterium fabrum C58

Annotation: xylose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 368 to 395 (28 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 227 (165 residues), 39.5 bits, see alignment E=1.9e-14 amino acids 233 to 426 (194 residues), 74.4 bits, see alignment E=4.4e-25

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 100% identity to atu:Atu3575)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CST8 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Atu3575 xylose ABC transporter permease (Agrobacterium fabrum C58)
MADMTQSNSTTSPKTEKTGSISRFISATELDTRLLGMVGALLLIWIGFHILSGGLFLTPR
NLWNLSVQTASVAVMATGMVLVIVTRNIDLSVGSILGFSGMIMGVMQAEILPQILGFEHW
ATWIVTLLVGILVGGAIGMLQGSIIAFLNVPSFIVTLGGLLVWRGGTWFVTSGRTVAPMD
STFRLMGGGTSGSIGATWSWIAAIVACVAIVAAILNSRHQRRRFGFPLRPVWAEYFLVAL
GCFVVVGFVAVVNSYPWPINIARNYADANGIAWPDGGLFIPHGIAIPVLMALAVGAVMTF
IATRLRFGRYVFAIGGNPEAAELAGIKTRWVTVKIFTLMGVLCAIAAAISTARLNAATNA
QGELDELYTIAAAVIGGTSLAGGVGTIAGAMLGALVMQSLQSGMVLVGIDTPFQRIVVGV
VLVVAVWLDTIYRARAK