Protein Info for Atu3560 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF13439: Glyco_transf_4" amino acids 66 to 182 (117 residues), 49.6 bits, see alignment E=1.4e-16 PF13579: Glyco_trans_4_4" amino acids 72 to 178 (107 residues), 39.2 bits, see alignment E=2.8e-13 PF00534: Glycos_transf_1" amino acids 199 to 359 (161 residues), 134.4 bits, see alignment E=9.1e-43 PF20706: GT4-conflict" amino acids 202 to 373 (172 residues), 30.2 bits, see alignment E=7.3e-11 PF13692: Glyco_trans_1_4" amino acids 205 to 346 (142 residues), 120.8 bits, see alignment E=1.7e-38 PF13524: Glyco_trans_1_2" amino acids 221 to 369 (149 residues), 36.3 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3560)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFD9 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu3560 glycosyltransferase (Agrobacterium fabrum C58)
MTSALFVSHTGEKGGAELFLADLVKAGPHSWRACFLSGGATAEDLAEAGRPPVMLSAGEK
MLSIRRNSSFGALARGAADVMAVAWQLSREAKHFDVICANSQKALFVCALAAKLSRRPLV
WILHDIVTDTAFSATNRRASLAFARIFARLVAVNSEETGRAFIEAGGEADKVRIVYNGFD
PAKAKLHDAGMAARLRAELGLGPQPLVGLFGRLSEWKGQHVFLDALAAMEGVQAVIVGGA
LFGQEAYEARIREQASRLGLDGRVRFLGFRSDVPELMASMDVVAHTSIVAEPFGRVVVEA
MMCGRPVVATRGGGVTEIIRDGETGLLVPPGDASALAAALGTILSDPALAQRLGQSGRED
VSDRFSLQETCRSVSALLTEAA