Protein Info for Atu3558 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 15 to 210 (196 residues), 65.5 bits, see alignment E=1.9e-21 PF13579: Glyco_trans_4_4" amino acids 16 to 207 (192 residues), 66.8 bits, see alignment E=8.8e-22 PF13477: Glyco_trans_4_2" amino acids 18 to 140 (123 residues), 24.7 bits, see alignment E=7.1e-09 PF20706: GT4-conflict" amino acids 167 to 361 (195 residues), 30.7 bits, see alignment E=5.2e-11 PF00534: Glycos_transf_1" amino acids 225 to 379 (155 residues), 76.4 bits, see alignment E=6.1e-25 PF13692: Glyco_trans_1_4" amino acids 231 to 364 (134 residues), 72 bits, see alignment E=1.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3558)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSS2 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Atu3558 glycosyltransferase (Agrobacterium fabrum C58)
MRILQITSLFSPDRVGGAEIFVEDLARGLADKGHTVAVAAISREQQMPEQRDGFAIHRLG
HTTPFFIGDWRQQPEWKRKYYKIAVQLDPRLVRRLARVIDELQPDVVNTHSLSELTPLIW
PMIRKRGIPLVHSLHDFTSMCTNGSLFHDGHICDGSSKKCRAFSYLHRRCQCSVDAVAGV
GRDIVERHVRAGFFTHVPESRRTVIWNAISPPDAPKPCTARAPGAPVAPLVFGYLGRIEA
AKGADLLIEALRFLPSQGWRLVMAGRAPDGIEAYQQKTAGLPVEFPGYVEANNFFAGIDC
LIVPPLWPEAFGRTVAEAILRGVPVIGANLAGVAEQIGPERQERLFAPGNAAELAARMAE
AMRNPAMLTETPETRERIRQGVAPEVVVAAYEKLYSDVRSSTQP