Protein Info for Atu3535 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 96 to 133 (38 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 308 (265 residues), 113.6 bits, see alignment E=4.7e-37

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu3535)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFC6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Atu3535 ABC transporter permease (Agrobacterium fabrum C58)
MITDNTLLRLARTDWFGPLLVTVMAIVVIRGFSPNFLSSFNIQILLLAISVNALIAFSQM
IIIAIGQMNLSVGAIGGLAAISFAGLMQVWGLPAPVAAIAAMLIGIVCGMLNGLLIAITG
ISAFVITLATLSIYKGINLGITRAEPFYGIPESVKDFGSALIVGPVPWLAAPTIIVAFAL
WFMLRRQPIGRFILAIGGNSHAAELSGISVRMTVIVAHGISGFLASVAGILLVSRLQIGQ
PSIGDDWLILSFAAPVIGGAVLAGGHVSVGATLLGVVIVAIITQALVLFSIDPFLVQVVL
GAMILAAVGINRLRETHLGKKTGKA