Protein Info for Atu3521 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 136 (127 residues), 40.2 bits, see alignment E=2.1e-14 amino acids 149 to 282 (134 residues), 61.6 bits, see alignment E=5.1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3521)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFB8 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Atu3521 permease (Agrobacterium fabrum C58)
MAPRDLAAYIFLAITWGVSFLLLLHVVAAFGWIGAVTLRSLITAVALYLIARAARRKLAF
SASWRAFAIVGATTVAGQLIGLSYATPQIGTAMAAILVATIPLFSMLISQMWGLERLTRQ
GIAGLVIGFAGIVLLVGFPAVPVTSGFIIGCAAAVAACICAAYGSNFASLHLKGVGSWEI
TIGSFLTGGLMTLPLLFAVPLPGTPDLVDYGYLLIQAVVMSGLTYITYFKLVSSIGATKA
ISVEFAVTVVAVLVGALVLDEPLSLPQLFGAGIIIFGCALVLDLLPKKKAPPTPSGA