Protein Info for Atu3516 in Agrobacterium fabrum C58

Annotation: MutT family NTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00586: mutator mutT protein
  • amino acids 6 to 133 (128 residues), 100.7 bits, E=3.1e-33
• PF00293: NUDIX
  • amino acids 11 to 131 (121 residues), 82.1 bits, E=3.8e-27
• PF14815: NUDIX_4
  • amino acids 13 to 130 (118 residues), 100.1 bits, E=6.6e-33

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to atu:Atu3516)

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See A9CFB7 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Atu3516 MutT family NTP pyrophosphatase (Agrobacterium fabrum C58)
MSEAGKKILLVAACALLDQDGRILLAQRPEGKSLAGLWEFPGGKVEQGETPEETLVRELD
EELGVKTKVACLAPLTFASHTYETFHLLMPLYVCRRYEGIAHGREGQALKWVKPQALRDY
PMPPADEPLIPFLQDLL