Protein Info for Atu3511 in Agrobacterium fabrum C58

Annotation: glutaredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR02181: glutaredoxin 3" amino acids 20 to 98 (79 residues), 115.5 bits, see alignment E=5e-38 PF00462: Glutaredoxin" amino acids 20 to 79 (60 residues), 83.8 bits, see alignment E=7.6e-28 PF13417: GST_N_3" amino acids 23 to 82 (60 residues), 29.3 bits, see alignment E=8.6e-11

Best Hits

Swiss-Prot: 61% identical to GLRX_PSEAE: Glutaredoxin (grx) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03676, glutaredoxin 3 (inferred from 100% identity to atu:Atu3511)

Predicted SEED Role

"Glutaredoxin 3 (Grx2)" in subsystem Glutaredoxins or Glutathione: Redox cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFB6 at UniProt or InterPro

Protein Sequence (100 amino acids)

>Atu3511 glutaredoxin (Agrobacterium fabrum C58)
MTLSCVLPHVCEALNNMAPVTIYTRDFCGYCARAKALLDMKGVDYAEYNATTTPEYRQEM
IEKSGGTTFPQIFINGQHVGGCDDLHALERAGKLDAMLAG