Protein Info for Atu3508 in Agrobacterium fabrum C58

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 13 to 241 (229 residues), 284.9 bits, see alignment E=1.9e-89 PF13489: Methyltransf_23" amino acids 44 to 214 (171 residues), 72 bits, see alignment E=2.6e-23 PF01209: Ubie_methyltran" amino acids 60 to 164 (105 residues), 22.8 bits, see alignment E=2.7e-08 PF08003: Methyltransf_9" amino acids 61 to 162 (102 residues), 25.4 bits, see alignment E=3.4e-09 PF13847: Methyltransf_31" amino acids 64 to 175 (112 residues), 55.2 bits, see alignment E=3.6e-18 PF02353: CMAS" amino acids 64 to 173 (110 residues), 44.4 bits, see alignment E=6.7e-15 PF06325: PrmA" amino acids 65 to 164 (100 residues), 25.1 bits, see alignment E=6.2e-09 PF05175: MTS" amino acids 67 to 174 (108 residues), 25.7 bits, see alignment E=3.8e-09 PF13649: Methyltransf_25" amino acids 68 to 160 (93 residues), 67.1 bits, see alignment E=9.2e-22 PF08242: Methyltransf_12" amino acids 69 to 161 (93 residues), 54 bits, see alignment E=1.2e-17 PF08241: Methyltransf_11" amino acids 69 to 163 (95 residues), 76.4 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 100% identical to UBIG_AGRFC: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to atu:Atu3508)

MetaCyc: 52% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UA66 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Atu3508 3-demethylubiquinone-9 3-methyltransferase (Agrobacterium fabrum C58)
MSETAQTTVDQSEVDRFSAMAAEWWSPTGKFRPLHKFNPVRLEYIRNRVCENFGRNPKAH
RPLEGLRVLDIGCGGGLLSEPVARMGATVVGADPSEKNIGIASTHARESGVSVDYRAVTA
EQLQEAGESFDVILNMEVVEHVANVDLFVTTCAKMVRPGGLMFAATINRTLKARALAIFA
AENVLRWLPRGTHQYEKLVRPEELERPIVASGMDIIHRTGVFYNVLQDRWNLSPDMEVNY
MMMAKRPAAA