Protein Info for Atu3502 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 19 to 276 (258 residues), 381.9 bits, see alignment E=1.6e-118 TIGR00969: sulfate ABC transporter, permease protein" amino acids 23 to 276 (254 residues), 304.8 bits, see alignment E=5.8e-95 PF00528: BPD_transp_1" amino acids 83 to 276 (194 residues), 53.7 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 54% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to atu:Atu3502)

MetaCyc: 54% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFB4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Atu3502 ABC transporter permease (Agrobacterium fabrum C58)
MSTVSRHRKPPRVGDAPLVRRSLIAFVLVIGALLVVAPLIIIGVEAFSQGWKVYSSTITH
PDTRHAIMLTVLTALIAVPVNTAFGVAAAWAITKFDFPGRRFLLVLIEIPFSISPIVAGV
AYLFVYGLQGLFGPFLDAHDIKILFALPGIVIASMFVTAPFVARELIPLMQAQGRDLEEA
ATSLGASGWRTFFSVTLPNIKWALLYGVVLCNARVMGEFGAVSVVSGNIRGQTNTLPLHI
ELLYHDYQTAGAFASASILALLAVVTIIAKVALERRGAGRGAKKTNGDAAIATET