Protein Info for Atu3501 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 240 (238 residues), 358.9 bits, see alignment E=6.3e-112 PF00005: ABC_tran" amino acids 19 to 162 (144 residues), 124 bits, see alignment E=7e-40

Best Hits

Swiss-Prot: 100% identical to CYSA2_AGRFC: Sulfate/thiosulfate import ATP-binding protein CysA 2 (cysA2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to atu:Atu3501)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UA73 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Atu3501 ABC transporter permease (Agrobacterium fabrum C58)
MKIRLENVVKTFDTFRAVRDVSLDIESGELLALLGPSGSGKTTILRMVAGLEYSDGGRIF
FGDEDATNIPVRDRGVGFVFQHYALFPHMTLHENIAFGMKVSKVKRDKAAIDARVKELLN
LVKLDGLGDRFPAQISGGQRQRVALARALSVDPKVLLLDEPFGALDANVRRDLRRWLREI
HDSLGITTIFVTHDQEEALDLADRVVILNQGGIVQQGTPKEVCRQPNSSFVMRFLGDANR
VSGVARGGKVYVGENELPFSYTQGDGAVDIYARPGDLEWEDLHEGIPASVERVLDRAGER
RVIASTDGGDILEFDVPPENDVTAGDRGSVIIRRAKIFPVA