Protein Info for Atu3488 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF00005: ABC_tran" amino acids 35 to 185 (151 residues), 106.4 bits, see alignment E=1.8e-34 amino acids 285 to 438 (154 residues), 85 bits, see alignment E=7.9e-28

Best Hits

Swiss-Prot: 100% identical to RBSA1_AGRFC: Ribose import ATP-binding protein RbsA 1 (rbsA1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10562, rhamnose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to atu:Atu3488)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, ATP-binding component" in subsystem L-rhamnose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UA86 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Atu3488 ABC transporter permease (Agrobacterium fabrum C58)
MRAETQTIKMTEASSPTPVLEMRGISQIFPGVKALDGVDIALYPGKVTALIGENGAGKST
LVKILTGIYRPNEGEILLDGKAVHFHSAQDAIDAGVTAIHQETVLFDELSVGENIFLGHA
PKGRFGLIDWKTINERARILLEQLESTIDPTIRLKDLSIAQRHLVAIARALSVEARIVIM
DEPTAALSRKEIDDLFRIVENLKRQGKAILFISHKFDEVYEIAENYAVFRDGKMVGAGTL
ATTPQDEIVRLMVGRDVTNAFPKQAVTLGPTVLSVRDYSHQTEFRDISLDLRKGEILGLY
GLIGAGRSELCQSLFGITRPASGEVTLDGQPLTIRSPEDAIRAGIVYVPEERGRHGLALD
MPIYQNMSLPSLTRTSRKGFLTAANEFALARKYAARLDLRAAALSVPVGTLSGGNQQKVV
IGKWLATKPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMISSELPEILGMSDRA
IVMREGLMAGQFERAEFSPEKLVRAATGNA