Protein Info for Atu3473 in Agrobacterium fabrum C58

Annotation: 2-oxoisovalerate dehydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF12573: OxoDH_E1alpha_N" amino acids 7 to 47 (41 residues), 69 bits, see alignment 2.4e-23 PF00676: E1_dh" amino acids 86 to 380 (295 residues), 308.9 bits, see alignment E=3.1e-96

Best Hits

Swiss-Prot: 63% identical to ODBA_PSEAE: 2-oxoisovalerate dehydrogenase subunit alpha (bkdA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00166, 2-oxoisovalerate dehydrogenase E1 component, alpha subunit [EC: 1.2.4.4] (inferred from 100% identity to atu:Atu3473)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF99 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Atu3473 2-oxoisovalerate dehydrogenase subunit alpha (Agrobacterium fabrum C58)
MDISETPHLSLHVPEPAVRPGGEPDFSNVKIPKAGTVPRPEVDAAPESMRDLAYSIIRVL
NHQGEAVGPWAGLLSDEDLLVGLKNMMRLRAFDARMLMAQRQGKTSFYMQHLGEEAVSCA
FRKALSKGDMNFPTYRQAGLLIADDYPLVTMMNQIYSNELDPLHGRQLPVLYSSKEHGFF
TVSGNLATQYVQAVGWAMASAIKGDTKIAAAWIGDGSTAESDFHSALVFASTYKAPVILN
IVNNQWAISTFQGIARGGSGTFAARGLGFGIPALRVDGNDYLAVYAVARWAVERARRNLG
PTLIEYVTYRVGAHSTSDDPSAYRPKTESEAWPLGDPVLRLKKHLILRGVWSEERHRQAE
AEIADEVLEAQREAESHGTLHEGKKPPKKDIFEGVYAEMPPHLARQRQKAGW