Protein Info for Atu3471 in Agrobacterium fabrum C58

Annotation: branched-chain alpha-keto acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 63.2 bits, see alignment E=2.5e-21 PF02817: E3_binding" amino acids 139 to 173 (35 residues), 46.5 bits, see alignment 5.1e-16 PF00198: 2-oxoacid_dh" amino acids 195 to 423 (229 residues), 264.9 bits, see alignment E=8.8e-83

Best Hits

KEGG orthology group: K09699, 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC: 2.3.1.168] (inferred from 100% identity to atu:Atu3471)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSJ7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu3471 branched-chain alpha-keto acid dehydrogenase subunit E2 (Agrobacterium fabrum C58)
MAEFVITMPDVGEGVAEAELVEWNVKPGDIVHEDMVLAAVMTDKATVEIPSPVAGIITWL
AVTVGNTVPVKAPLVRIETDVAAAAPNGSAPEAEAPSRMTEEEAPADMTEAPPPVETQPA
ARQTEEAPSAPVAEPHHKPLASPAVRQRADDLDIDLIKVKGTGPDGHITHADLDGFLTVR
ARPERPEPMTPHDSAVEEVKVTGLRRKIAEKMVLSVSRIPHITYVEEIDVTELEDLRATM
NGNRRSGQPKLTILPFLMRALVKAVADHPGMNAIFDDEKGVVSHYEAVHIGIATQTPAGL
TVPVVRHAETLGLWDCAEEVARVAEAARTGTAHREELMGSTITISSLGALGGVVSTPIIN
HPEVAIIGVNKIMTRPVWDGNRFVPRKMMNLSSSFDHRVVDGWDAAVFIQAVKALLEKPA
LIFIE