Protein Info for Atu3460 in Agrobacterium fabrum C58

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 204 (190 residues), 110.5 bits, see alignment E=3.7e-36

Best Hits

Swiss-Prot: 37% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3460)

Predicted SEED Role

"putative amino acid efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSI7 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Atu3460 RhtB family transporter (Agrobacterium fabrum C58)
MIDVTLLAFAVVAFIGIATPGPTVLLALANGSKFGVRRAMIGMAGAVLSDVVLIGAVALG
LGALLAASEFWFGVVKWVGVCYLVFLGIMLLRSRGMLGALGSTEENGAASARSIFLKSFL
VAVTNPKGYLFFSAFLPQFIDPAAPQIQQYAVLALVFAGIDFIVMFGYALLGAQAVRVLR
KSGALWLDRICGGALLTLAASLALYRRASA